PDB entry 4kt0

View 4kt0 on RCSB PDB site
Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
Class: electron transport
Keywords: photosynthetic reaction center, membrane complex, plastocyanin, cytochrome C6, Ferredoxin, ELECTRON TRANSPORT
Deposited on 2013-05-19, released 2014-02-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: BEST7613_2234, MYO_18690, psaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0a_
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaB, BEST7613_2235, MYO_18700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0b_
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaC, BEST7613_5694, MYO_120930
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0c_
  • Chain 'D':
    Compound: Photosystem I subunit II
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaD, BEST7613_1459, MYO_11100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0d_
  • Chain 'E':
    Compound: photosystem I reaction center subunit IV
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaE, BEST7613_5968, MYO_118260
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0e_
  • Chain 'F':
    Compound: Photosystem I subunit III
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaF, BEST7613_2928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0f_
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaJ, BEST7613_2927, MYO_115450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kt0j_
  • Chain 'K':
    Compound: Photosystem I reaction center subunit PsaK
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psaK, BEST7613_4536, MYO_129960
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosystem I reaction center subunit XII
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: psbM, psaM, BEST7613_1787, MYO_14340
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PQN, SF4, LHG, CL0, BCR, CLA, LMU, LMG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kt0A (A:)
    mtisppereakakvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfds
    qtsdledvsrkifsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpi
    vgqgilngdvgggfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhy
    hvkapklewfqnvesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplph
    efilepskmaelypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlai
    avlfiiaghmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallg
    sltiivaqhmyamppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpak
    nvnnlldrmlrhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqp
    ifaqwvqhlhtlapgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaf
    tihvtalillkgvlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyn
    slsivifhfswkmqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvins
    ygsalsaygimflaghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsi
    iqgravgvahyllggivttwafflarslsig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt0A (A:)
    kvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfdsqtsdledvsrki
    fsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpivgqgilngdvgg
    gfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhyhvkapklewfqn
    vesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplphefilepskmael
    ypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlaiavlfiiaghmyr
    tnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallgsltiivaqhmya
    mppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpaknvnnlldrmlrh
    rdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpifaqwvqhlhtl
    apgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaftihvtalillkg
    vlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivifhfswk
    mqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvinsygsalsaygimf
    laghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsiiqgravgvahyl
    lggivttwafflarslsig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kt0B (B:)
    matkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflw
    tsgtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgv
    yhwfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhla
    glfgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdta
    ghifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighs
    ikeilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafia
    qdhttqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishl
    swvslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpd
    siasttgaawlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgaldarg
    sklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgvws
    gnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgfmf
    liswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvltyaa
    fliastagkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt0B (B:)
    tkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflwts
    gtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgvyh
    wfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhlagl
    fgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdtagh
    ifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighsik
    eilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafiaqd
    httqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishlsw
    vslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpdsi
    asttgaawlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgaldargsk
    lmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgvwsgn
    vaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgfmfli
    swrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvltyaafl
    iastagkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kt0C (C:)
    mshsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacpt
    dflsirvylgaettrsmglay
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt0C (C:)
    shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
    flsirvylgaettrsmglay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kt0D (D:)
    mtelsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllyla
    rkeqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktr
    rigqnpepvtikfsgkapyev
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt0D (D:)
    elsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylark
    eqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrri
    gqnpepvtikfsgkapye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kt0E (E:)
    malnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnn
    faenelelvqaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt0E (E:)
    alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
    aenelelv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kt0F (F:)
    mkhllalllaftlwfnfapsasaddfanltpcsenpaylaksknflnttndpnsgkirae
    ryasalcgpegyphlivdgrfthagdflipsilflyiagwigwvgrsylieiresknpem
    qevvinvplaikkmlggflwplaavgeytsgklvmkdseiptspr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt0F (F:)
    dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
    gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
    vgeytsgklvmkdseiptspr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kt0J (J:)
    mdglksflstapvmimalltftagiliefnrfypdllfhp
    

  • Chain 'K':
    No sequence available.

  • Chain 'M':
    No sequence available.