PDB entry 4ksl

View 4ksl on RCSB PDB site
Description: Gumby/Fam105B in complex with linear di-ubiquitin
Class: hydrolase
Keywords: OTU domain, deubiquitinase, linear diubiquitin, HYDROLASE
Deposited on 2013-05-17, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.226
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'B':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'C':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslc1, d4kslc2
  • Chain 'D':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ksld1, d4ksld2
  • Chain 'E':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'F':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslf1, d4kslf2
  • Chain 'G':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'H':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslh1, d4kslh2
  • Chain 'I':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'J':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslj1, d4kslj2
  • Chain 'K':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'L':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ksll1, d4ksll2
  • Chain 'M':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'N':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ksln1, d4ksln2
  • Chain 'O':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'P':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslp1, d4kslp2
  • Chain 'Q':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'R':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslr1, d4kslr2
  • Chain 'S':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'T':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslt1, d4kslt2
  • Chain 'U':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'V':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslv1, d4kslv2
  • Chain 'W':
    Compound: Protein FAM105B
    Species: Homo sapiens [TaxId:9606]
    Gene: FAM105B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BN8 (2-End)
      • engineered mutation (52)
  • Chain 'X':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kslx1, d4kslx2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kslC (C:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslC (C:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kslD (D:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslD (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kslF (F:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslF (F:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4kslH (H:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslH (H:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4kslJ (J:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslJ (J:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4kslL (L:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslL (L:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4kslN (N:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslN (N:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4kslP (P:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslP (P:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4kslR (R:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslR (R:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4kslT (T:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslT (T:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4kslV (V:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslV (V:)
    gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrl
    ifagkqledgrtlsdyniqkestlhlvlrl
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4kslX (X:)
    gamgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdq
    qrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kslX (X:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrl