PDB entry 4ks3

View 4ks3 on RCSB PDB site
Description: Influenza Neuraminidase in complex with antiviral compound (3S,4R,5R)-4-(acetylamino)-3-[4-(3-hydroxypropyl)-1H-1,2,3-triazol-1-yl]-5-(pentan-3-yloxy)cyclohex-1-ene-1-carboxylic acid
Class: hydrolase/hydrolase inhibitor
Keywords: Sialidase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-05-17, released 2013-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.139
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385580]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ks3a_
  • Heterogens: 1SL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ks3A (A:)
    tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvkvgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqvrkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyeiadwswhdgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ks3A (A:)
    tymnnteaicdvkgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
    khsngtvkdrspfrtlmsvkvgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
    vavihyggvptdvinswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
    iigqadisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
    sdtprgedaqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
    tqtskeqvrkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
    ssivmcgvdyeiadwswhdgailpfdid