PDB entry 4krl

View 4krl on RCSB PDB site
Description: Nanobody/VHH domain 7D12 in complex with domain III of the extracellular region of EGFR, pH 6.0
Class: transferase/immune system
Keywords: cell surface receptor, glycoprotein, nanobody, VHH domain, Camelid VH domain, antibody, antigen, antibody complex, TRANSFERASE-IMMUNE SYSTEM complex
Deposited on 2013-05-16, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d4krla1, d4krla2, d4krla3
  • Chain 'B':
    Compound: Nanobody/VHH domain 7D12
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KRL (0-End)
    Domains in SCOPe 2.07: d4krlb_
  • Heterogens: MES, NAG, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4krlA (A:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrecvdkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4krlA (A:)
    leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvscrnvsrgrec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4krlB (B:)
    qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
    adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
    tvssalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4krlB (B:)
    qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
    adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
    tv