PDB entry 4kpx

View 4kpx on RCSB PDB site
Description: Hin GlmU bound to WG766
Class: transferase/transferase inhibitor
Keywords: beta helix, cell wall biosynthesis, small molecule inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-05-14, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Haemophilus influenzae [TaxId:727]
    Gene: glmU, HI_0642
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kpxa1, d4kpxa2
  • Heterogens: SO4, MG, PG4, 1SE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kpxA (A:)
    mtkkalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggd
    lmrthlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketlekliea
    kpengialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasf
    kkwlarvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfq
    nkqasklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlkn
    vvigndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgsk
    vnhltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangat
    igagttitrdvgenelvitrvaqrhiqgwqrpikkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kpxA (A:)
    kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
    thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
    ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
    larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
    asklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvi
    gndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnh
    ltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatiga
    gttitrdvgenelvitrvaqrhiqgwqrpi