PDB entry 4kpq

View 4kpq on RCSB PDB site
Description: Structure and receptor binding specificity of the hemagglutinin H13 from avian influenza A virus H13N6
Class: viral protein
Keywords: receptor binding, VIRAL PROTEIN
Deposited on 2013-05-14, released 2013-07-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:384499]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13103 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d4kpqa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:384499]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:384499]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13103 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d4kpqc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:384499]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:384499]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13103 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d4kpqe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:384499]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kpqA (A:)
    iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
    gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
    ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
    hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
    tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
    gdcpkyiksgqlklatglrnvpaisnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kpqA (A:)
    iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
    gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
    ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
    hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
    tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
    gdcpkyiksgqlklatglrnvpai
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kpqC (C:)
    iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
    gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
    ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
    hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
    tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
    gdcpkyiksgqlklatglrnvpaisnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kpqC (C:)
    iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
    gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
    ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
    hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
    tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
    gdcpkyiksgqlklatglrnvpai
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kpqE (E:)
    iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
    gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
    ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
    hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
    tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
    gdcpkyiksgqlklatglrnvpaisnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kpqE (E:)
    iqdricvgylstnsservdtllengvpvtssidlietnhtgtycslngvspvhlgdcsfe
    gwivgnpactsnfgirewsyliedpaaphglcypgelnnngelrhlfsgirsfsrtelip
    ptswgevldgttsacrdntgtnsfyrnlvwfikknnrypvisktynnttgrdvlvlwgih
    hpvsvdetktlyvnsdpytlvstkswsekykletgvrpgyngqrswmkiywslihpgemi
    tfesnggflaprygyiieeygkgrifqsrirmsrcntkcqtsvggintnrtfqnidknal
    gdcpkyiksgqlklatglrnvpai
    

  • Chain 'F':
    No sequence available.