PDB entry 4kph

View 4kph on RCSB PDB site
Description: Structure of the Fab fragment of N62, a protective monoclonal antibody to the nonreducing end of Francisella tularensis O-antigen
Class: immune system
Keywords: antibody, immunoglobulin, immune system, Carbohydrate/Sugar Binding, plasma
Deposited on 2013-05-13, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: N62 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4KPH (Start-211)
  • Chain 'I':
    Compound: N62 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4KPH (0-211)
  • Chain 'L':
    Compound: N62 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4KPH (0-209)
    Domains in SCOPe 2.07: d4kphl1, d4kphl2
  • Chain 'M':
    Compound: N62 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4KPH (0-End)
    Domains in SCOPe 2.07: d4kphm1, d4kphm2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kphL (L:)
    eivltqspaimsaslgeeitltcsasssvnymhwyqqksgtspklliyttsnlasgvpsr
    fsgsgsgtfysltissveaedaadyychqwssyptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4kphM (M:)
    eivltqspaimsaslgeeitltcsasssvnymhwyqqksgtspklliyttsnlasgvpsr
    fsgsgsgtfysltissveaedaadyychqwssyptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kphM (M:)
    eivltqspaimsaslgeeitltcsasssvnymhwyqqksgtspklliyttsnlasgvpsr
    fsgsgsgtfysltissveaedaadyychqwssyptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwvlnswtdqdskdstysmsstltltkyerhnsytc
    eathktstspivksfn