PDB entry 4kov

View 4kov on RCSB PDB site
Description: Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with Cefuroxime
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2013-05-12, released 2013-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kova_
  • Heterogens: SO4, KOV, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4kovA (A:)
ghmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhd
gqvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscf
nanaaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep

    Sequence, based on observed residues (ATOM records): (download) 
    >4kovA (A:)
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple