PDB entry 4koq

View 4koq on RCSB PDB site
Description: Crystal Structure of WHY3 from Arabidopsis thaliana
Class: DNA binding protein
Keywords: Plant, Whirly, SINGLE-STRANDED DNA BINDING PROTEIN, DNA BINDING PROTEIN
Deposited on 2013-05-12, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein WHY3, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g02740, PTAC11, T20F6.12, WHY3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66GR6 (Start-168)
      • expression tag (169-173)
    Domains in SCOPe 2.06: d4koqa1, d4koqa2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4koqA (A:)
    maevssprfyvghsiykgkaaltieprapefvalesgafkltkegflllqfapaagvrqy
    dwsrkqvfslsvteignlvslgpresceffhdpfkgkgdegkvrkvlkveplpdgsgrff
    nlsvqnkllnvdesvyipitkaefavlisafnfvlphligwsafansikaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4koqA (A:)
    sprfyvghsiykgkaaltieprapefvalesgafkltkegflllqfapaagvrqydwsrk
    qvfslsvteignlvslgpresceffhdpfkgkgdegkvrkvlkveplpdgsgrffnlsvq
    nkllnvdesvyipitkaefavlisafnfvlphligwsafansikaaale