PDB entry 4kom

View 4kom on RCSB PDB site
Description: The structure of hemagglutinin from avian-origin H7N9 influenza virus in complex with avian receptor analog 3'SLNLN (NeuAcα2-3Galβ1-4GlcNAcβ1-3Galβ1-4Glc)
Class: viral protein
Keywords: homotrimer, virus attachment and membrane fusion, VIRAL PROTEIN
Deposited on 2013-05-12, released 2013-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4KOM (0-313)
    Domains in SCOPe 2.03: d4koma_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4KOM (Start-168)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4komA (A:)
    iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
    ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
    ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
    tklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfngaf
    iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
    rslllatgmknvpe
    

  • Chain 'B':
    No sequence available.