PDB entry 4ko7

View 4ko7 on RCSB PDB site
Description: Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48F/V95I)
Class: electron transport
Keywords: cupredoxin fold, computational protein design, copper binding, ELECTRON TRANSPORT
Deposited on 2013-05-11, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (30)
      • engineered mutation (47)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4ko7a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (30)
      • engineered mutation (47)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4ko7b_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (30)
      • engineered mutation (47)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4ko7c_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (30)
      • engineered mutation (47)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4ko7d_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ko7A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftinlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ko7B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftinlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ko7C (C:)
    aecsvdiqgndqmqfntnaitvdksckqftinlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ko7D (D:)
    aecsvdiqgndqmqfntnaitvdksckqftinlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqymffctfpghsal
    mkgtltlk