PDB entry 4knr

View 4knr on RCSB PDB site
Description: Hin GlmU bound to WG188
Class: transferase/transferase inhibitor
Keywords: beta helix, cell wall biosynthesis, inhibitor bound, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-05-10, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Haemophilus influenzae [TaxId:727]
    Gene: glmU, HI_0642
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4knra1, d4knra2
  • Heterogens: 1S8, PG4, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4knrA (A:)
    mtkkalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggd
    lmrthlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketlekliea
    kpengialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasf
    kkwlarvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfq
    nkqasklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlkn
    vvigndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgsk
    vnhltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangat
    igagttitrdvgenelvitrvaqrhiqgwqrpikkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4knrA (A:)
    kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
    thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
    ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
    larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
    asklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvi
    gndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnh
    ltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatiga
    gttitrdvgenelvitrvaqrhiqgwqrpi