PDB entry 4kn8

View 4kn8 on RCSB PDB site
Description: Crystal structure of Bs-TpNPPase
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2013-05-09, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable NPPase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kn8a_
  • Chain 'B':
    Compound: Thermostable NPPase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kn8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kn8A (A:)
    mrgshhhhhhgsmrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstr
    tpeqvadklvsldipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsf
    adenadvvivgldrevtyeklavaclavrngaklistngdlalptergfmpgngaftali
    shstqvkatfvgkpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtg
    vttveklkeykqqptysmkslddwkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kn8A (A:)
    mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
    dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
    drevtyeklavaclavrngaklistngdlalptergfmpgngaftalishstqvkatfvg
    kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
    qptysmkslddwkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kn8B (B:)
    mrgshhhhhhgsmrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstr
    tpeqvadklvsldipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsf
    adenadvvivgldrevtyeklavaclavrngaklistngdlalptergfmpgngaftali
    shstqvkatfvgkpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtg
    vttveklkeykqqptysmkslddwkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kn8B (B:)
    mrkyngylidldgtmyaasgfikelnrlhipylfvtnnstrtpeqvadklvsldipatpe
    qiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgldrevtye
    klavaclavrngaklistngdlalptergfmpgngaftalishstqvkatfvgkpepiim
    eqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveykqqptysmksldd
    wkfl