PDB entry 4kn3

View 4kn3 on RCSB PDB site
Description: Structure of the Y34NS91G double mutant of Dehaloperoxidase from Amphitrite ornata with 2,4,6-trichlorophenol
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: GLOBIN, OXYGEN STORAGE, PEROXIDASE, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2013-05-08, released 2013-09-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.137
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (33)
      • engineered mutation (90)
    Domains in SCOPe 2.04: d4kn3a_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (33)
      • engineered mutation (90)
    Domains in SCOPe 2.04: d4kn3b_
  • Heterogens: HEM, T6C, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kn3A (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kn3B (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk