PDB entry 4klz

View 4klz on RCSB PDB site
Description: Inhibition of Small GTPases by Stabilization of the GDP Complex, a Novel Approach applied to Rit1, a Target for Rheumatoid Arthritis
Class: protein binding
Keywords: small GTPase, molecular switch (GTPase), GDP/GTP binding, PROTEIN BINDING, GUANINE NUCLEOTIDE BINDING
Deposited on 2013-05-07, released 2014-09-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Rit1
    Species: Homo sapiens [TaxId:9606]
    Gene: RIT1, RIBB, RIT, ROC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4klza_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4klzA (A:)
    gssreyklvmlgaggvgksamtmqfishrfpedhdptiedaykiririddepanldildt
    agqaeftamrdqymragegfiicysitdrrsfhevrefkqliyrvrrtddtpvvlvgnks
    dlkqlrqvtkeeglalarefscpffetsaayryyiddvfhalvreirrkekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4klzA (A:)
    eyklvmlgaggvgksamtmqfishrfpedhdptiedaykiririddepanldildtagqy
    mragegfiicysitdrrsfhevrefkqliyrvrrtddtpvvlvgnksdlkqlrqvtkeeg
    lalarefscpffetsaayryyiddvfhalvreirrk