PDB entry 4kl7

View 4kl7 on RCSB PDB site
Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis
Class: hydrolase
Keywords: cell wall hydrolase, HYDROLASE
Deposited on 2013-05-07, released 2013-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.147
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rpfB, Rv1009, MT1038, MTC1237.26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4kl7a_
  • Chain 'B':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rpfB, Rv1009, MT1038, MTC1237.26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4kl7b_
  • Chain 'C':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rpfB, Rv1009, MT1038, MTC1237.26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4kl7c_
  • Chain 'D':
    Compound: Resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rpfB, Rv1009, MT1038, MTC1237.26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4kl7d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kl7A (A:)
    siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
    trlrqgwgawpvcaaragar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kl7B (B:)
    siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
    trlrqgwgawpvcaaragar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kl7C (C:)
    siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
    trlrqgwgawpvcaaragar
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kl7D (D:)
    siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
    trlrqgwgawpvcaaragar