PDB entry 4kl7
View 4kl7 on RCSB PDB site
Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis
Class: hydrolase
Keywords: cell wall hydrolase, HYDROLASE
Deposited on
2013-05-07, released
2013-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2013-06-26, with a file datestamp of
2013-06-21.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.147
AEROSPACI score: 0.69
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Resuscitation-promoting factor rpfB
Species: Mycobacterium tuberculosis [TaxId:1773]
Gene: rpfB, Rv1009, MT1038, MTC1237.26
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4kl7a_ - Chain 'B':
Compound: Resuscitation-promoting factor rpfB
Species: Mycobacterium tuberculosis [TaxId:1773]
Gene: rpfB, Rv1009, MT1038, MTC1237.26
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4kl7b_ - Chain 'C':
Compound: Resuscitation-promoting factor rpfB
Species: Mycobacterium tuberculosis [TaxId:1773]
Gene: rpfB, Rv1009, MT1038, MTC1237.26
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4kl7c_ - Chain 'D':
Compound: Resuscitation-promoting factor rpfB
Species: Mycobacterium tuberculosis [TaxId:1773]
Gene: rpfB, Rv1009, MT1038, MTC1237.26
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4kl7d_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4kl7A (A:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4kl7B (B:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>4kl7C (C:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>4kl7D (D:)
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar