PDB entry 4kl1

View 4kl1 on RCSB PDB site
Description: HCN4 CNBD in complex with cGMP
Class: protein transport
Keywords: CNBD, cAMP, cGMP, c-di-GMP, c-di-AMP, ion channel, HCN, Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel, cAMP binding, cGMP binding, PROTEIN TRANSPORT
Deposited on 2013-05-07, released 2014-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kl1a_
  • Chain 'B':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kl1b_
  • Chain 'C':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kl1c_
  • Chain 'D':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
    Species: Homo sapiens [TaxId:9606]
    Gene: HCN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kl1d_
  • Heterogens: PCG, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kl1A (A:)
    gpsspmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgels
    eplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevle
    eypmmrrafetvaldrldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kl1A (A:)
    dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
    iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaldrldr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kl1B (B:)
    gpsspmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgels
    eplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevle
    eypmmrrafetvaldrldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kl1B (B:)
    dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
    iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaldrldr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kl1C (C:)
    gpsspmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgels
    eplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevle
    eypmmrrafetvaldrldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kl1C (C:)
    dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
    iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaldrldr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kl1D (D:)
    gpsspmdssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgels
    eplreeiinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevle
    eypmmrrafetvaldrldr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kl1D (D:)
    dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
    iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
    rafetvaldrldr