PDB entry 4kkn

View 4kkn on RCSB PDB site
Description: Crystal structure of bovine CTLA-4, PSI-NYSGRC-012704
Class: immune system
Keywords: Ig-like V-type domain, Ig superfamily, IMMUNE SYSTEM, extracellular, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, Atoms-to-Animals: The Immune Function Network, IFN
Deposited on 2013-05-06, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxic T-lymphocyte associated protein 4
    Species: Bos taurus [TaxId:9913]
    Gene: CTLA-4, CTLA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kkna_
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kknA (A:)
    qdyggkgmnvtqppvvlassrgvasfsceyessgkadevrvtvlreagsqvtevcagtym
    vedeltflddstcigtsrgnkvnltiqglramdtglyvckvelmypppyyvgigngtqiy
    vidpepaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kknA (A:)
    gmnvtqppvvlassrgvasfsceyessgkadevrvtvlreagsqvtevcagtymvedelt
    flddstcigtsrgnkvnltiqglramdtglyvckvelmypppyyvgigngtqiyvid