PDB entry 4kkn

View 4kkn on RCSB PDB site
Description: Crystal structure of bovine CTLA-4, PSI-NYSGRC-012704
Class: immune system
Keywords: Ig-like V-type domain, Ig superfamily, IMMUNE SYSTEM, extracellular, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2013-05-06, released 2013-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxic T-lymphocyte associated protein 4
    Species: Bos taurus [TaxId:9913]
    Gene: CTLA-4, CTLA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kkna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4kknA (A:)
qdyggkgmnvtqppvvlassrgvasfsceyessgkadevrvtvlreagsqvtevcagtym
vedeltflddstcigtsrgnkvnltiqglramdtglyvckvelmypppyyvgigngtqiy
vidpepaenlyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >4kknA (A:)
gmnvtqppvvlassrgvasfsceyessgkadevrvtvlreagsqvtevcagtymvedelt
flddstcigtsrgnkvnltiqglramdtglyvckvelmypppyyvgigngtqiyvid