PDB entry 4kkl

View 4kkl on RCSB PDB site
Description: Structure of the E148A mutant of CLC-ec1 delta NC construct in 100mM fluoride
Class: tranport protein, membrane protein
Keywords: membrane transporter, tranport protein, membrane protein
Deposited on 2013-05-06, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.251
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (1-444)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d4kkla_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered mutation (132)
    Domains in SCOPe 2.07: d4kklb_
  • Chain 'C':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KKL (Start-221)
    Domains in SCOPe 2.07: d4kklc1, d4kklc2
  • Chain 'D':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KKL (0-210)
    Domains in SCOPe 2.07: d4kkld1, d4kkld2
  • Chain 'E':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KKL (Start-221)
    Domains in SCOPe 2.07: d4kkle1, d4kkle2
  • Chain 'F':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KKL (0-210)
    Domains in SCOPe 2.07: d4kklf1, d4kklf2
  • Heterogens: F

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kklA (A:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kklA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kklB (B:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kklB (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
    lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
    nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
    lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
    ftggkplysailartlakqea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kklC (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kklC (C:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kklD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kklE (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kklE (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kklF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra