PDB entry 4kkf

View 4kkf on RCSB PDB site
Description: Complex structure of catalytic domain of CLOSTRIDIUM cellulovorans ExgS and cellobiose
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-05-06, released 2014-05-14
Made obsolete by 4xwm on 2015-10-28

The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.142
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exoglucanase S
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: ExgS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kkfa_
  • Heterogens: CBK, CBI, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kkfA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefaapvvpnneyvqhfkdmyakih
    nanngyfsdegipyhavetlmveapdyghettseafsyymwleamnakltgdfsgfkkaw
    dvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmypsqlqfgaavgkdplynelk
    stygtsqvygmhwlldvdnwygfggatstspvyintfqrgvqescwetvpqpckdemkyg
    grngfldlftgdsqyatqfkytnapdadaravqatyyaqlaakewgvdissyvakstkmg
    dflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgggissnwswrigsshnhfgyq
    npmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlqsaeggiaggasnsnggsyqa
    wpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvaeyyysskdpaakslldkwakw
    acanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlhvkveaygedlgvagslsnal
    syyakalesstdaadkvayntaketsrkildylwasyqddkgiavtetrndfkrfnqsvy
    ipsgwtgkmpngdviqsgatflsirskykqdpswpnveaalangtgvdmtyhrfwgqsdi
    aiafgtygtlftdptpglkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkfA (A:)
    vpnneyvqhfkdmyakihnanngyfsdegipyhavetlmveapdyghettseafsyymwl
    eamnakltgdfsgfkkawdvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmyps
    qlqfgaavgkdplynelkstygtsqvygmhwlldvdnwygfggatstspvyintfqrgvq
    escwetvpqpckdemkyggrngfldlftgdsqyatqfkytnapdadaravqatyyaqlaa
    kewgvdissyvakstkmgdflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgggi
    ssnwswrigsshnhfgyqnpmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlqsa
    eggiaggasnsnggsyqawpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvaeyy
    ysskdpaakslldkwakwacanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlhvk
    veaygedlgvagslsnalsyyakalesstdaadkvayntaketsrkildylwasyqddkg
    iavtetrndfkrfnqsvyipsgwtgkmpngdviqsgatflsirskykqdpswpnveaala
    ngtgvdmtyhrfwgqsdiaiafgtygtlft