PDB entry 4kke

View 4kke on RCSB PDB site
Description: The crystal structure of AMP-bound JNK3
Class: transferase
Keywords: kinase domain, kinase, c-jun, TRANSFERASE
Deposited on 2013-05-06, released 2014-05-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kkea_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kkeA (A:)
    mgskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsr
    pfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvie
    qlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardlls
    kmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliyke
    vmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkeA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartasfmmtpyvvt
    ryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpef
    mkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpak
    risvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn