PDB entry 4kk8

View 4kk8 on RCSB PDB site
Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in 100mM fluoride
Class: transport protein
Keywords: membrane transporter, TRANSPORT PROTEIN
Deposited on 2013-05-05, released 2013-08-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.212
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: b0155, clcA, eriC, JW5012, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (1-End)
      • engineered mutation (132)
    Domains in SCOPe 2.03: d4kk8a_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: b0155, clcA, eriC, JW5012, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (1-End)
      • engineered mutation (132)
    Domains in SCOPe 2.03: d4kk8b_
  • Chain 'C':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KK8 (Start-221)
    Domains in SCOPe 2.03: d4kk8c1, d4kk8c2
  • Chain 'D':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KK8 (0-210)
    Domains in SCOPe 2.03: d4kk8d1, d4kk8d2
  • Chain 'E':
    Compound: Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KK8 (Start-221)
    Domains in SCOPe 2.03: d4kk8e1, d4kk8e2
  • Chain 'F':
    Compound: Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KK8 (0-210)
    Domains in SCOPe 2.03: d4kk8f1, d4kk8f2
  • Heterogens: F

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kk8A (A:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kk8A (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kk8B (B:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kk8B (B:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kk8C (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kk8C (C:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kk8D (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kk8E (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kk8E (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kk8F (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra