PDB entry 4kjo

View 4kjo on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L36A/V66T/V99T at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, pdtp, cavity, pressure, HYDROLASE
Deposited on 2013-05-03, released 2013-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (35)
      • engineered mutation (43-44)
      • engineered mutation (59)
      • engineered mutation (92)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4kjoa_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4kjoA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrallvdtpefnekygpeasaftkkmt
enakkievefdkgqrtdkygrglayiyadgkmtnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >4kjoA (A:)
lhkepatlikaidgdtvklmykgqpmtfrallvdtpefnekygpeasaftkkmtenakki
evefdkgqrtdkygrglayiyadgkmtnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws