PDB entry 4kjh

View 4kjh on RCSB PDB site
Description: Crystal structure of the complex of ribosome inactivating protein from Momordica balsamina with cytosine at 1.98 A resolution
Class: hydrolase
Keywords: Ribosome inactivating protein, Complex hydrolase, Ligand binding, Hydrolase
Deposited on 2013-05-03, released 2013-05-22
Made obsolete by 4zt8 on 2015-08-05

The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA N-glycosidase
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kjha_
  • Heterogens: NAG, GOL, CYT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kjhA (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni