PDB entry 4kiv

View 4kiv on RCSB PDB site
Description: recombinant kringle iv-10/w72r mutant of human apolipoprotein(a)
Deposited on 1998-08-26, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d4kiv__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4kiv_ (-)
  qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
  wcftmdpsirreycnltrc