PDB entry 4kiv

View 4kiv on RCSB PDB site
Description: recombinant kringle IV-10/w72r mutant of human apolipoprotein(a)
Class: lysine binding site
Keywords: lysine binding site, site mutation
Deposited on 1998-08-26, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08519 (0-78)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d4kiva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kivA (A:)
    qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
    wcftmdpsirreycnltrc