PDB entry 4kih

View 4kih on RCSB PDB site
Description: Catalytic domain of Clostridium cellulovorans ExgS
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-05-02, released 2014-05-07
Made obsolete by 4xwl on 2015-10-28

The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.148
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exoglucanase S
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: ExgS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kiha_
  • Heterogens: PEG, PG4, P33, PGE, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kihA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefaapvvpnneyvqhfkdmyakih
    nanngyfsdegipyhavetlmveapdyghettseafsyymwleamnakltgdfsgfkkaw
    dvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmypsqlqfgaavgkdplynelk
    stygtsqvygmhwlldvdnwygfggatstspvyintfqrgvqescwetvpqpckdemkyg
    grngfldlftgdsqyatqfkytnapdadaravqatyyaqlaakewgvdissyvakstkmg
    dflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgggissnwswrigsshnhfgyq
    npmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlqsaeggiaggasnsnggsyqa
    wpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvaeyyysskdpaakslldkwakw
    acanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlhvkveaygedlgvagslsnal
    syyakalesstdaadkvayntaketsrkildylwasyqddkgiavtetrndfkrfnqsvy
    ipsgwtgkmpngdviqsgatflsirskykqdpswpnveaalangtgvdmtyhrfwgqsdi
    aiafgtygtlftdptpglkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kihA (A:)
    apvvpnneyvqhfkdmyakihnanngyfsdegipyhavetlmveapdyghettseafsyy
    mwleamnakltgdfsgfkkawdvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsm
    ypsqlqfgaavgkdplynelkstygtsqvygmhwlldvdnwygfggatstspvyintfqr
    gvqescwetvpqpckdemkyggrngfldlftgdsqyatqfkytnapdadaravqatyyaq
    laakewgvdissyvakstkmgdflrysffdkyfrkvgnstqagtgydsaqyllnwyyawg
    ggissnwswrigsshnhfgyqnpmaawilsntsdfkpkspnaatdwnnslkrqiefyqwl
    qsaeggiaggasnsnggsyqawpagtrtfygmgytphpvyedpgsnewfgmqawsmqrva
    eyyysskdpaakslldkwakwacanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnl
    hvkveaygedlgvagslsnalsyyakalesstdaadkvayntaketsrkildylwasyqd
    dkgiavtetrndfkrfnqsvyipsgwtgkmpngdviqsgatflsirskykqdpswpnvea
    alangtgvdmtyhrfwgqsdiaiafgtygtlftd