PDB entry 4ki3

View 4ki3 on RCSB PDB site
Description: 1.70 Angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lolA) from Yersinia pestis CO92
Class: chaperone
Keywords: IDP02066, Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, CHAPERONE
Deposited on 2013-05-01, released 2013-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3a_
  • Chain 'B':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3b_
  • Chain 'C':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3c_
  • Chain 'D':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3d_
  • Chain 'E':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3e_
  • Chain 'F':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3f_
  • Chain 'G':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3g_
  • Chain 'H':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3h_
  • Chain 'I':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3i_
  • Chain 'J':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3j_
  • Chain 'K':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3k_
  • Chain 'L':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Yersinia pestis biovar Medievalis [TaxId:547048]
    Gene: lolA, YPC_2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki3l_
  • Heterogens: ACT, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ki3A (A:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3A (A:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksl
    kqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ki3B (B:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3B (B:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksl
    kqfaisvtpsgtiksftaveqdgqrsaytlkaskftftppkgvtlddqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ki3C (C:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3C (C:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksl
    kqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ki3D (D:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3D (D:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
    nlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ki3E (E:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3E (E:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksk
    qfaisvtpsgtiksftaveqdgqrsaytlksaskftftppkgvtlddqr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ki3F (F:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3F (F:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksl
    kqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ki3G (G:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3G (G:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
    slkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ki3H (H:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3H (H:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
    nlkqfaisvtpsgtiksftaveqdgqrsaytlksaskftftppkgvtlddqr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ki3I (I:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3I (I:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
    gnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4ki3J (J:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3J (J:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksl
    kqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4ki3K (K:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3K (K:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
    lkqfaisvtpsgtiksftaveqdgqrsaytlksaskftftppkgvtlddqr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ki3L (L:)
    snadastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdes
    vlisdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltp
    ksasgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtl
    ddqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki3L (L:)
    dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
    sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksk
    qfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr