PDB entry 4kha

View 4kha on RCSB PDB site
Description: Structural basis of histone H2A-H2B recognition by the essential chaperone FACT
Class: chaperone/nuclear protein
Keywords: tandem PHL, Pleckstrin-homology like, U-turn motif, Histone Chaperone, chromatin, transcription, Histones, Nucleus, CHAPERONE-NUCLEAR PROTEIN complex
Deposited on 2013-04-30, released 2013-05-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.193
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spt16M-Histone H2B 1.1 chimera
    Species: Chaetomium thermophilum var. thermophilum, Xenopus laevis [TaxId:759272,8355]
    Gene: CTHT_0052370, CTHT_0052370
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AZJ8 (3-91)
      • expression tag (0-2)
    Domains in SCOPe 2.03: d4khab_
  • Heterogens: CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4khaB (B:)
agraktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaa
rdnkktriiprhlqlavrndeelnkllgrvti