PDB entry 4kh0

View 4kh0 on RCSB PDB site
Description: The R state structure of E. coli ATCase with ATP and Magnesium bound
Class: transferase
Keywords: pyrimidine nucleotide biosynthesis, feedback inhibition, competing pathway product activation, allostery, TRANSFERASE
Deposited on 2013-04-29, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrB, EKO11_4066, KO11_22860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kh0a1, d4kh0a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrI, EKO11_4067, KO11_22855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kh0b1, d4kh0b2
  • Chain 'C':
    Compound: aspartate carbamoyltransferase
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrB, EKO11_4066, KO11_22860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kh0c1, d4kh0c2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrI, EKO11_4067, KO11_22855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kh0d1, d4kh0d2
  • Heterogens: PAL, ZN, ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kh0A (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kh0B (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kh0B (B:)
    dnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikien
    tflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvss
    sfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kh0C (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kh0D (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kh0D (D:)
    thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
    entflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepv
    sssfavrkrandialkckycekefshnvvlan