PDB entry 4kgx

View 4kgx on RCSB PDB site
Description: The R state structure of E. coli ATCase with CTP bound
Class: transferase
Keywords: pyrimidine nucleotide biosynthesis, feedback inhibition, competing pathway product activation, allostery, TRANSFERASE
Deposited on 2013-04-29, released 2013-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrB, EKO11_4066, KO11_22860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kgxa1, d4kgxa2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrI, EKO11_4067, KO11_22855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kgxb1, d4kgxb2
  • Chain 'C':
    Compound: aspartate carbamoyltransferase
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrB, EKO11_4066, KO11_22860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kgxc1, d4kgxc2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:595495]
    Gene: pyrI, EKO11_4067, KO11_22855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kgxd1, d4kgxd2
  • Heterogens: PAL, ZN, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kgxA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kgxB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgxB (B:)
    veaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflse
    dqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavr
    krandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kgxC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kgxD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgxD (D:)
    aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
    vdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrkr
    andialkckycekefshnvvlan