PDB entry 4kdt

View 4kdt on RCSB PDB site
Description: Structure of an early native-like intermediate of beta2-microglobulin amyloidosis
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-04-25, released 2013-08-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody24
    Species: Camelidae [TaxId:9835]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KDT (0-End)
  • Chain 'B':
    Compound: Nanobody24
    Species: Camelidae [TaxId:9835]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KDT (0-End)
  • Chain 'C':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769
      • engineered mutation (32)
    Domains in SCOPe 2.03: d4kdtc_
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769
      • engineered mutation (32)
    Domains in SCOPe 2.03: d4kdtd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kdtC (C:)
    miqrtpkiqvysrhpaengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kdtC (C:)
    tpkiqvysrhpengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskdwsfyl
    lyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kdtD (D:)
    miqrtpkiqvysrhpaengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kdtD (D:)
    rtpkiqvysrhpaengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskdwsf
    yllyyteftptekdeyacrvnhvtlsqpkivkwdr