PDB entry 4kdq

View 4kdq on RCSB PDB site
Description: Crystal structure of the hemagglutinin of A/Xinjiang/1/2006 virus
Class: viral protein
Keywords: homotrimer, virus attachment and membrane fusion, VIRAL PROTEIN
Deposited on 2013-04-25, released 2013-07-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:577543]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:279728]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:577543]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kdqc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:279728]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:577543]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:279728]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kdqC (C:)
sdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdeflnvpewsyivekinpvndlcypgnfndyeelkhllsrinhfekiqiipk
sswsdheassgvssacpyqgrssffrnvvwlikknntyptikrsynntnqedllvlwgih
hpndaaeqtrlyqnpttyisvgtstlnqrlvpklatrskvngqsgrmeffwtilkpndai
nfesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihplti
gecpkyvksnrlvlatglrns

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.