PDB entry 4kdl

View 4kdl on RCSB PDB site
Description: Crystal structure of p97/VCP N in complex with OTU1 UBXL
Class: signaling protein/hydrolase
Keywords: AAA ATPase, UBX-like domain, PROTEIN BINDING, PROTEIN-PROTEIN COMPLEX, beta-barrel, beta-grasp, SIGNALING PROTEIN-HYDROLASE complex
Deposited on 2013-04-25, released 2014-03-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kdla1, d4kdla2
  • Chain 'B':
    Compound: Ubiquitin thioesterase OTU1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: OTU1, YFL044C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43558 (17-89)
      • expression tag (16)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kdlA (A:)
    gshmasmtggqqmgrgsnrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkk
    rreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtv
    egitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvih
    cegepikredeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kdlA (A:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    

  • Chain 'B':
    No sequence available.