PDB entry 4kd6

View 4kd6 on RCSB PDB site
Description: Crystal structure of a Enoyl-CoA hydratase/isomerase from Burkholderia graminis C4D1M
Class: isomerase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, PROTEIN STRUCTURE INITIATIVE, alpha/beta, trimeric assembly, lipid metabolism, Crotonase superfamily, enoyl-CoA, ISOMERASE
Deposited on 2013-04-24, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Burkholderia graminis [TaxId:396598]
    Gene: BgramDRAFT_6579
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kd6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kd6A (A:)
    mhhhhhhssgvdlgtenlyfqsmsndvlfsnhgrvavitlnrperlnawttpmretiida
    lerfnrdpevaaiimtgagnrafsagqdlseahdfdgeravawvkewqryytalrslskp
    lvmalngtaagsafqvallgdirvghpgvrmgqpeinagiasttgpwimnamlgmsrtie
    ltltgrlmeaeechriglihhlvdedkvfdkaleiatelaakppvamrldkqrfremtep
    gfidcieageriqreaydsgeparmmeeffskrak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kd6A (A:)
    dvlfsnhgrvavitlnrperlnawttpmretiidalerfnrdpevaaiimtgagnrafsa
    gqdlswvkewqryytalrslskplvmalngtaagsafqvallgdirvghpgvrmgqpein
    agiasttgpwimnamlgmsrtieltltgrlmeaeechriglihhlvdedkvfdkaleiat
    elaakppvamrldkqrfremtepgfidcieageri