PDB entry 4kd4

View 4kd4 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant V23L/L25V/V66I/I72V at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, pdtp, cavity, pressure, HYDROLASE
Deposited on 2013-04-24, released 2013-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.179
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (24)
      • engineered mutation (65)
      • engineered mutation (71)
    Domains in SCOPe 2.05: d4kd4a_
  • Heterogens: CA, THP, MRD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kd4A (A:)
    atstkklhkepatlikaidgdtlkvmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmienakkvevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kd4A (A:)
    lhkepatlikaidgdtlkvmykgqpmtfrlllvdtpetkhpvekygpeasaftkkmiena
    kkvevefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlrkse
    aqakkeklniws