PDB entry 4kbq

View 4kbq on RCSB PDB site
Description: Structure of the CHIP-TPR domain in complex with the Hsc70 Lid-Tail domains
Class: ligase/protein binding
Keywords: TPR, E3 ubiquitin ligase, Hsc70, LIGASE-PROTEIN BINDING complex
Deposited on 2013-04-23, released 2015-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CHIP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHIP, PP1131, STUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbqa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase CHIP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHIP, PP1131, STUB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbqb_
  • Chain 'C':
    Compound: Heat shock cognate 71 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HSC70, HSP73, HSPA10, HSPA8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11142 (8-100)
      • expression tag (2-7)
    Domains in SCOPe 2.06: d4kbqc1, d4kbqc2
  • Chain 'D':
    Compound: Heat shock cognate 71 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HSC70, HSP73, HSPA10, HSPA8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11142 (8-100)
      • expression tag (2-7)
    Domains in SCOPe 2.06: d4kbqd1, d4kbqd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kbqA (A:)
    gamgsekspsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqq
    heqaladcrraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddi
    psalriakkkrwnsieerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbqA (A:)
    psaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqaladc
    rraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalriak
    kkrwnsieer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kbqB (B:)
    gamgsekspsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqq
    heqaladcrraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddi
    psalriakkkrwnsieerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbqB (B:)
    spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqheqalad
    crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
    kkkrwn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kbqC (C:)
    gidpftefslesyafnmkatvedeklqgkindedkqkildkcneiinwldknqtaekeef
    ehqqkelekvcnpiitklyqsaggmpggmpggfgptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbqC (C:)
    dpftefslesyafnmkatvedeklqgkindedkqkildkcneiinwldknqtaekeefeh
    qqkelekvcnpiitklyqsaggmpptieevd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kbqD (D:)
    gidpftefslesyafnmkatvedeklqgkindedkqkildkcneiinwldknqtaekeef
    ehqqkelekvcnpiitklyqsaggmpggmpggfgptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbqD (D:)
    dpftefslesyafnmkatvedekkindedkqkildkcneiinwldknqtaefehqqkele
    kvcnpiitklyqsaggmpggptieevd