PDB entry 4kbp

View 4kbp on RCSB PDB site
Description: kidney bean purple acid phosphatase
Class: hydrolase (phosphoric monoester)
Keywords: purple acid phosphatase, hydrolase (phosphoric monoester)
Deposited on 1995-10-02, released 1996-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.06: d4kbpa1, d4kbpa2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.06: d4kbpb1, d4kbpb2
  • Chain 'C':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.06: d4kbpc1, d4kbpc2
  • Chain 'D':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.06: d4kbpd1, d4kbpd2
  • Heterogens: NAG, FE, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kbpA (A:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbpA (A:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kbpB (B:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbpB (B:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kbpC (C:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbpC (C:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kbpD (D:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbpD (D:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst