PDB entry 4kba

View 4kba on RCSB PDB site
Description: CK1d in complex with 9-[3-(4-fluorophenyl)-1-methyl-1H-pyrazol-4-yl]-2,3,4,5-tetrahydropyrido[2,3-f][1,4]oxazepine inhibitor
Class: transferase/transferase inhibitor
Keywords: ser/thr kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-04-23, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbaa_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbab_
  • Chain 'C':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbac_
  • Chain 'D':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbad_
  • Heterogens: 1QM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kbaA (A:)
    mhhhhhhssglvprgslrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkh
    pqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvl
    lladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhip
    yrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkye
    risekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydy
    vfdwnmlkfgasraaddaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbaA (A:)
    lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqgg
    vgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsk
    nfihrdvkpdnflmglgkkgnlvyiidfglakkygtaryasinthlgieqsrrddleslg
    yvlmyfnlgslpwqglrisekkmstpievlckgypsefatylnfcrslrfddkpdysylr
    qlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kbaB (B:)
    mhhhhhhssglvprgslrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkh
    pqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvl
    lladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhip
    yrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkye
    risekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydy
    vfdwnmlkfgasraaddaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbaB (B:)
    lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecqlhieskiykmmqggvgipti
    rwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrd
    vkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgi
    eqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsef
    atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kbaC (C:)
    mhhhhhhssglvprgslrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkh
    pqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvl
    lladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhip
    yrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkye
    risekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydy
    vfdwnmlkfgasraaddaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbaC (C:)
    nryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgip
    tirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfih
    rdvkpdnflmglgkkgnlvyiidfglakkyyrenknltgtaryasinthlgieqsrrddl
    eslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatylnfcr
    slrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kbaD (D:)
    mhhhhhhssglvprgslrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkh
    pqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvl
    lladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhip
    yrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkye
    risekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydy
    vfdwnmlkfgasraaddaererrdreerlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbaD (D:)
    lrvgnryrlgrkigdiylgtdiaageevaiklecpqlhieskiykmmqggvgiptirwcg
    aegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkpd
    nflmglgkkgnlvyiidfglakkyhipyrenknltgtaryasinthlgieqsrrddlesl
    gyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatylnfcrslr
    fddkpdysylrqlfrnlfhrqgfsydyvfdwnml