PDB entry 4kaq

View 4kaq on RCSB PDB site
Description: Structure of rituximab Fab
Class: immune system
Keywords: monoclonal antibody, immune system
Deposited on 2013-04-22, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.182
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Rituximab heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606,10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4KAQ (0-End)
  • Chain 'L':
    Compound: Rituximab light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606,10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4KAQ (Start-212)
    Domains in SCOPe 2.07: d4kaql1, d4kaql2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4kaqL (L:)
    qivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvr
    fsgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kaqL (L:)
    vlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvrfs
    gsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleikrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrgec