PDB entry 4kam

View 4kam on RCSB PDB site
Description: X-ray crystal structure of O-acetylhomoserine sulfhydrylase MetC from Mycobacterium marinum ATCC BAA-535 / M
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, O-acetylhomoserine sulfhydrylase, TRANSFERASE
Deposited on 2013-04-22, released 2013-05-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetylhomoserine sulfhydrylase MetC
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: metC, MMAR_1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kama_
  • Chain 'B':
    Compound: O-acetylhomoserine sulfhydrylase MetC
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: metC, MMAR_1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kamb_
  • Chain 'C':
    Compound: O-acetylhomoserine sulfhydrylase MetC
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: metC, MMAR_1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kamc_
  • Chain 'D':
    Compound: O-acetylhomoserine sulfhydrylase MetC
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: metC, MMAR_1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kamd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kamA (A:)
    gpgsmsaentstdadptahwsfetkqihagqqpdsatnaralpiyqttsytfentahaaa
    lfglevpgniytrlgnpttdvveqriaaleggvaalflssgqaaetfailnlagagdhiv
    ssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntkaffgetisnpqidll
    dtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkylgghgaaiagvivdg
    gtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlgsaaspfnaflvaqg
    letlslrierhvsnaqrvaefladredvvtvnyaglpgspwherakklspkgtgavlsfe
    laggveagkafvnalklhshvanigdvrslvihpastthaqlspaeqlstgvspglvrla
    vgiegiediladlelgfaaarkfsgdsqavaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kamA (A:)
    ptahwsfetkqihagqqpdsalpiyqttsnpttdvveqriaaleggvaalflssgqaaet
    failnlagagdhivssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntka
    ffgetisnpqidlldtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkyl
    gghgaaiagvivdggtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlg
    saaspfnaflvaqgletlslrierhvsnaqrvaefladredvvtvnyaglpgspwherak
    klspkgtgavlsfelaggveagkafvnalklhshvanigdvrslvihglvrlavgiegie
    diladlelgfaaarkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kamB (B:)
    gpgsmsaentstdadptahwsfetkqihagqqpdsatnaralpiyqttsytfentahaaa
    lfglevpgniytrlgnpttdvveqriaaleggvaalflssgqaaetfailnlagagdhiv
    ssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntkaffgetisnpqidll
    dtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkylgghgaaiagvivdg
    gtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlgsaaspfnaflvaqg
    letlslrierhvsnaqrvaefladredvvtvnyaglpgspwherakklspkgtgavlsfe
    laggveagkafvnalklhshvanigdvrslvihpastthaqlspaeqlstgvspglvrla
    vgiegiediladlelgfaaarkfsgdsqavaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kamB (B:)
    ptahwsfetkqihagqnaralpiyqttstrlgnpttdvveqriaaleggvaalflssgqa
    aetfailnlagagdhivssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpn
    tkaffgetisnpqidlldtpgvaevahrngiplivdntiatpylirpftqgadivvhsat
    kylgghgaaiagvivdggtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllr
    dlgsaaspfnaflvaqgletlslrierhvsnaqrvaefladredvvtvnyaglpgspwhe
    rakklspkgtgavlsfelaggveagkafvnalklhshvanigdvrslvihspglvrlavg
    iegiediladlelgfaaarkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kamC (C:)
    gpgsmsaentstdadptahwsfetkqihagqqpdsatnaralpiyqttsytfentahaaa
    lfglevpgniytrlgnpttdvveqriaaleggvaalflssgqaaetfailnlagagdhiv
    ssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntkaffgetisnpqidll
    dtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkylgghgaaiagvivdg
    gtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlgsaaspfnaflvaqg
    letlslrierhvsnaqrvaefladredvvtvnyaglpgspwherakklspkgtgavlsfe
    laggveagkafvnalklhshvanigdvrslvihpastthaqlspaeqlstgvspglvrla
    vgiegiediladlelgfaaarkfsgdsqavaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kamC (C:)
    ptahwsfetkqihagqqpdsatlpiyqttsrlgnpttdvveqriaaleggvaalflssgq
    aaetfailnlagagdhivssprlyggtynlfhyslaklgievsfvddpdnldswqaavrp
    ntkaffgetisnpqidlldtpgvaevahrngiplivdntiatpylirpftqgadivvhsa
    tkylgghgaaiagvivdggtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqll
    rdlgsaaspfnaflvaqgletlslrierhvsnaqrvaefladredvvtvnyaglpgspwh
    erakklspkgtgavlsfelaggveagkafvnalklhshvanigdvrslvihspglvrlav
    giegiediladlelgfaaarkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kamD (D:)
    gpgsmsaentstdadptahwsfetkqihagqqpdsatnaralpiyqttsytfentahaaa
    lfglevpgniytrlgnpttdvveqriaaleggvaalflssgqaaetfailnlagagdhiv
    ssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntkaffgetisnpqidll
    dtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkylgghgaaiagvivdg
    gtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlgsaaspfnaflvaqg
    letlslrierhvsnaqrvaefladredvvtvnyaglpgspwherakklspkgtgavlsfe
    laggveagkafvnalklhshvanigdvrslvihpastthaqlspaeqlstgvspglvrla
    vgiegiediladlelgfaaarkfsgdsqavaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kamD (D:)
    hwsfetkqihagqnaralpiyqttsyrlgnpttdvveqriaaleggvaalflssgqaaet
    failnlagagdhivssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntka
    ffgetisnpqidlldtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkyl
    gghgaaiagvivdggtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlg
    saaspfnaflvaqgletlslrierhvsnaqrvaefladredvvtvnyaglpgspwherak
    klspkgtgavlsfelakafvnalklhshvanigdvrslvihpspglvrlavgiegiedil
    adlelgfa