PDB entry 4kab

View 4kab on RCSB PDB site
Description: FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH 3-Methyl-1,4-dihydro-pyrazolo[4,5-c]pyrazole
Class: Transferase/Transferase Inhibitor
Keywords: TYROSINE PROTEIN KINASE, TRANSFERASE, ATP BINDING, Transferase-Transferase Inhibitor complex
Deposited on 2013-04-22, released 2013-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.173
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kaba_
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kabb_
  • Heterogens: 4KA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kabA (A:)
    gspstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kabA (A:)
    trdyeiqrerielgrcigegqfgdvhqgiymsppalavaiktcknctsdsvrekflqeal
    tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
    layleskrfvhrdiaarnvlvssndcvklgdflpikwmapesinfrrftsasdvwmfgvc
    mweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprfte
    lkaqlstileeekaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kabB (B:)
    gspstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kabB (B:)
    dyeiqrerielgrcigegqfgdvhqgiymspepalavaiktcknctsdsvrekflqealt
    mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
    ayleskrfvhrdiaarnvlvssndcvklgdfglsrymlpikwmapesinfrrftsasdvw
    mfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrr
    prftelkaqlstileeek