PDB entry 4ka0

View 4ka0 on RCSB PDB site
Description: Crystal structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus (target NYSGRC-011676), space group P21221
Class: oxidoreductase
Keywords: PUTATIVE DISULFIDE OXIDOREDUCTASE, NYSGRC, Structural Genomics, New York Structural Genomics Research Consortium, PSI-Biology, OXIDOREDUCTASE
Deposited on 2013-04-21, released 2013-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative thiol-disulfide oxidoreductase
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_2222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ka0a_
  • Chain 'B':
    Compound: Putative thiol-disulfide oxidoreductase
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_2222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ka0b_
  • Chain 'C':
    Compound: Putative thiol-disulfide oxidoreductase
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_2222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ka0c_
  • Chain 'D':
    Compound: Putative thiol-disulfide oxidoreductase
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_2222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ka0d_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ka0A (A:)
    mslnadfateiegkivqaskllpgqpaidfemldvegnvkhladfkgkviyidlwatwcg
    pciqespafealgkkyvgkdivflpvstdtttkpwlryldghkkeltqyhsndvalkesw
    aimyiprfilidkdfnivnayaprpsseeigtlidsvlnkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ka0A (A:)
    askllpgqpaidfemldvegnvkhladfkgkviyidlwatwcgpciqespafealgkkyv
    gkdivflpvstdtttkpwlryldghkkeltqyhsndvalkeswaimyiprfilidkdfni
    vnayaprpsseeigtlidsvlnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ka0B (B:)
    mslnadfateiegkivqaskllpgqpaidfemldvegnvkhladfkgkviyidlwatwcg
    pciqespafealgkkyvgkdivflpvstdtttkpwlryldghkkeltqyhsndvalkesw
    aimyiprfilidkdfnivnayaprpsseeigtlidsvlnkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ka0B (B:)
    skllpgqpaidfemldvegnvkhladfkgkviyidlwatwcgpciqespafealgkkyvg
    kdivflpvstdtttkpwlryldghkkeltqyhsndvalkeswaimyiprfilidkdfniv
    nayaprpsseeigtlidsvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ka0C (C:)
    mslnadfateiegkivqaskllpgqpaidfemldvegnvkhladfkgkviyidlwatwcg
    pciqespafealgkkyvgkdivflpvstdtttkpwlryldghkkeltqyhsndvalkesw
    aimyiprfilidkdfnivnayaprpsseeigtlidsvlnkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ka0C (C:)
    askllpgqpaidfemldvegnvkhladfkgkviyidlwatwcgpciqespafealgkkyv
    gkdivflpvstdtttkpwlryldghkkeltqyhsndvalkeswaimyiprfilidkdfni
    vnayaprpsseeigtlidsvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ka0D (D:)
    mslnadfateiegkivqaskllpgqpaidfemldvegnvkhladfkgkviyidlwatwcg
    pciqespafealgkkyvgkdivflpvstdtttkpwlryldghkkeltqyhsndvalkesw
    aimyiprfilidkdfnivnayaprpsseeigtlidsvlnkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ka0D (D:)
    askllpgqpaidfemldvegnvkhladfkgkviyidlwatwcgpciqespafealgkkyv
    gkdivflpvstdtttkpwlryldghkkeltqyhsndvalkeswaimyiprfilidkdfni
    vnayaprpsseeigtlidsvl