PDB entry 4k9y

View 4k9y on RCSB PDB site
Description: FOCAL ADHESION KINASE Catalytic domain in complex with 1-[4-(6-Amino-purin-9-yl)-phenyl]-3-(5-tert-butyl-2-p-tolyl-2H-pyrazol-3-yl)-urea
Class: Transferase/Transferase Inhibitor
Keywords: TYROSINE PROTEIN KINASE, TRANSFERASE, ATP BINDING, Transferase-Transferase Inhibitor complex
Deposited on 2013-04-21, released 2013-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k9ya_
  • Heterogens: K9Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k9yA (A:)
    gspstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrek
    flqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilya
    yqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpik
    wmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppnc
    pptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9yA (A:)
    yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
    mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
    ayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesi
    nfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlysl
    mtkcwaydpsrrprftelkaqlstileeeka