PDB entry 4k9t

View 4k9t on RCSB PDB site
Description: Complex of CYP3A4 with a desoxyritonavir analog
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: cytochrome P450 3A4, alpha-beta protein, cytochrome P450 fold, monooxygenase, cytochrome P450 reductase, endoplasmic reticulum, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2013-04-21, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A3, CYP3A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4k9ta_
  • Heterogens: HEM, 1RD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k9tA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9tA (A:)
    shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
    miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
    iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
    kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtdflq
    lmidsqalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnk
    apptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalh
    rdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqn
    fsfkpcketqiplklslggllqpekpvvlkvesrd