PDB entry 4k9p

View 4k9p on RCSB PDB site
Description: Crystal Structure of the His281Tyr/Ala460Ile Double Mutant of Benzoylformate Decarboxylase from Pseudomonas putida
Class: lyase
Keywords: Thiamine Diphosphate, LYASE
Deposited on 2013-04-20, released 2013-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-End)
      • engineered mutation (279)
      • engineered mutation (458)
    Domains in SCOPe 2.06: d4k9pa1, d4k9pa2, d4k9pa3
  • Chain 'B':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-End)
      • engineered mutation (279)
      • engineered mutation (458)
    Domains in SCOPe 2.06: d4k9pb1, d4k9pb2, d4k9pb3
  • Chain 'C':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-End)
      • engineered mutation (279)
      • engineered mutation (458)
    Domains in SCOPe 2.06: d4k9pc1, d4k9pc2, d4k9pc3
  • Chain 'D':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-End)
      • engineered mutation (279)
      • engineered mutation (458)
    Domains in SCOPe 2.06: d4k9pd1, d4k9pd2, d4k9pd3
  • Heterogens: CA, TPP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k9pA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9pA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k9pB (B:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9pB (B:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k9pC (C:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9pC (C:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k9pD (D:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9pD (D:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygilrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvs