PDB entry 4k9g

View 4k9g on RCSB PDB site
Description: 1.55 A Crystal Structure of Macrophage Migration Inhibitory Factor bound to ISO-66 and a related compound
Class: isomerase
Keywords: cytokine, secreted/endocytosed, ISOMERASE
Deposited on 2013-04-19, released 2014-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.199
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4k9ga_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4k9gb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: GLIF, MIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4k9gc_
  • Heterogens: 1Q2, 1Q1, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k9gA (A:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k9gB (B:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k9gC (C:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa