PDB entry 4k9f

View 4k9f on RCSB PDB site
Description: Neutron structure of Perdeuterated Rubredoxin refined against 1.75 resolution data collected on the new IMAGINE instrument at HFIR, ORNL
Class: electron transport
Keywords: iron, metal-binding, transport, electron transport
Deposited on 2013-04-19, released 2013-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: NEUT
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1282, rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4k9fa_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k9fA (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9fA (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekle