PDB entry 4k8l

View 4k8l on RCSB PDB site
Description: Crystal structure of a putative 4-hydroxyproline epimerase/3-hydroxyproline dehydratse from the soil bacterium ochrobacterium anthropi, target efi-506495, disordered loops
Class: isomerase
Keywords: PROLINE RACEMASE, PROPOSED 3-OH PROLINE DEHYDRATASE, EFI, ENZYME FUNCTION INTIATIVE, Structural Genomics, Enzyme Function Initiative, ISOMERASE
Deposited on 2013-04-18, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline racemase
    Species: Ochrobactrum anthropi [TaxId:439375]
    Gene: Oant_0439
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6WW16 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4k8la1, d4k8la2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k8lA (A:)
    smrstkvihivgchaegevgdvivggvapppgktvweqsrfiasdetlrnfvlneprggv
    frhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiipmqepvtrmvle
    apgglieveaecrngkaerisvrnvpsfadrlnasleveglgtitvdtayggdsfvivda
    asigmkiepgqarelaeigvkitkaaneqlgfrhpekdwnhisfcqitepvtrdgdiltg
    vntvairpakldrsptgtgcsarmavlhakgqmkvgerfigksvlgtefhcrldktlelg
    gkpaispiisgrawvtgtsqlmldpsdpfpsgyrlsdtwpnmpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k8lA (A:)
    smrstkvihivgchaegevgdvivggvapppgktvweqsrfiasdetlrnfvlneprggv
    frhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiipmqepvtrmvle
    apgglieveaecrngkaerisvrnvpsfadrlnaslevgtitvdtayggdsfvivdaasi
    gmelaeigvkitkaaneqlgfrhpekdwnhisfcqitepvtrdgdiltgvntvaitgtgc
    sarmavlhakgqmkvgerfighcrldktlelggkpaispiisgrawvtgtsqlmldpsdp
    fpsgy